2. Search Result
Search Result
Results for "

C-terminal peptide

" in MedChemExpress (MCE) Product Catalog:

31

Inhibitors & Agonists

43

Peptides

1

Natural
Products

Targets Recommended:
Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-P2746
    Carboxypeptidase B, Porcine pancreas

    EC 3.4.2.2

    		 Endogenous Metabolite Metabolic Disease
    Carboxypeptidase B, Porcine pancreas (EC 3.4.2.2) is a peptide exonuclease that can specifically degrade peptide chains. Carboxypeptidase B is progressively degraded from the C-terminal to release free amino acids. Carboxypeptidase B hydrolyzes only peptide bonds with basic amino acids (such as arginine and lysine) as C-terminal residues .
    Carboxypeptidase B, Porcine pancreas
  • HY-E70201
    Carboxypeptidase B (MS grade)

    EC 3.4.2.2 (MS grade)

    		 Endogenous Metabolite Others
    Carboxypeptidase B (MS grade) is a peptide exonuclease that can specifically degrade peptide chains. Carboxypeptidase B (MS grade) is progressively degraded from the C-terminal to release free amino acids. Carboxypeptidase B (MS grade) hydrolyzes only peptide bonds with basic amino acids (such as arginine and lysine) as C-terminal residues .
    Carboxypeptidase B (MS grade)
  • HY-P3418
    CKLF1-C27

    		CCR ERK Inflammation/Immunology
    CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research .
    CKLF1-C27
  • HY-P5923
    E70K

    		CXCR Inflammation/Immunology
    E70K is a CXCL8 C-terminal peptide with a substitution of glutamic acid (E) 70 with lysine (K). E70K can reduce neutrophil adhesion and migration during inflammation .
    E70K
  • HY-P5147
    α-Conotoxin GID

    		nAChR Neurological Disease
    α-Conotoxin GID is a paralytic peptide neurotoxin and a selective antagonist of nAChR, with IC50s of 5 nM (α7), 3 nM (α3β2)， 150 nM (α4β2), respectively. α-Conotoxin GID is small disulfide-rich peptide, with potential to inhibit chronic pain. α-Conotoxin GID contains a C-terminal carboxylate, thus substitution with a C-terminal carboxamide results in loss of α4β2 nAChR. α-Conotoxin GID can be isolated from the Conus species .
    α-Conotoxin GID
  • HY-P3418A
    CKLF1-C27 TFA

    		CCR ERK Inflammation/Immunology
    CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research .
    CKLF1-C27 TFA
  • HY-P1465
    Secretin (28-54), human

    Human secretin

    		 Secretin Receptor Metabolic Disease Cancer
    Secretin (28-54), human is a 27-amino acid residue C-terminally amidated peptide, which acts on human secretin receptors .
    Secretin (28-54), human
  • HY-P1465A
    Secretin (28-54), human TFA

    Human secretin TFA

    		 Secretin Receptor Metabolic Disease Cancer
    Secretin (28-54), human TFA is a 27-amino acid residue C-terminally amidated peptide, which acts on human secretin receptors .
    Secretin (28-54), human TFA
  • HY-P0199
    Pancreatic Polypeptide, human

    Human pancreatic polypeptide

    		 Neuropeptide Y Receptor Metabolic Disease Endocrinology
    Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.
    Pancreatic Polypeptide, human
  • HY-P0144
    Thrombospondin-1 (1016-1023) (human, bovine, mouse)

    		Apoptosis Inflammation/Immunology
    Thrombospondin-1 (1016-1023) (human, bovine, mouse), is the C-terminal end of the native sequence of Thrombospondin-1 (TSP-1), is a CD47 agonist peptide .
    Thrombospondin-1 (1016-1023) (human, bovine, mouse)
  • HY-P1841
    Glucagon-Like Peptide (GLP) II, human

    		Endogenous Metabolite Apoptosis Metabolic Disease
    Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
    Glucagon-Like Peptide (GLP) II, human
  • HY-P5124
    β-Amyloid peptide(16-20)

    KLVFF

    		 Amyloid-β Neurological Disease
    β-Amyloid peptide(16-20) is a amino acid sequences (KLVFF) of Amyloid-β (Abeta). β-Amyloid peptide(16-20) is an effective inhibitor of Abeta fibril formation, with RG-/-GR-NH2 residues added at N- and C-terminal ends to aid solubility) .
    β-Amyloid peptide(16-20)
  • HY-P5391
    LL-37(17-32)

    		Bacterial Others
    LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)
    LL-37(17-32)
  • HY-P1191
    JIP-1(153-163)

    TI-JIP; JIP-1 peptide; JIPtide

    		 JNK Others
    JIP-1(153-163) (TI-JIP) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
    JIP-1(153-163)
  • HY-P1191A
    JIP-1(153-163) TFA

    TI-JIP TFA; JIP-1 peptide TFA; JIPtide TFA

    		 JNK Others
    JIP-1(153-163) TFA (TI-JIP TFA) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
    JIP-1(153-163) TFA
  • HY-P5497
    C34 peptide

    		HIV Others
    C34 peptide is a biological active peptide. (This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.)
    C34 peptide
  • HY-P2980
    Carboxypeptidase A, Bovine pancreas

    EC 3.4.2.1

    		 Endogenous Metabolite Others
    Carboxypeptidase A, Bovine pancreas (EC 3.4.2.1) is a zinc-containing metalloprotease, is often used in biochemical studies. Carboxypeptidase A catalyzes the hydrolysis of the peptide bonds that are adjacent to the C-terminal end of a polypeptide chain. Carboxypeptidase A is a prototypical enzyme for metalloproteases that plays important roles in biological systems .
    Carboxypeptidase A, Bovine pancreas
  • HY-P5370
    Scrambled β-amyloid (1-40)

    		Amyloid-β Others
    Scrambled β-amyloid (1-40) is a biological active peptide. (Aβ (1-40) together with Aβ (1-42) are two major C-terminal variants of the Aβ protein constituting the majority of Aβs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40 HY-P0265)
    Scrambled β-amyloid (1-40)
  • HY-P5182
    HsTX1

    		Potassium Channel Inflammation/Immunology
    HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
    HsTX1
  • HY-107024
    Osteogenic Growth Peptide (10-14)

    OGP(10-14); Historphin

    		 Src Others
    Osteogenic Growth Peptide (10-14) (OGP(10-14)), the C-terminal truncated pentapeptide of osteogenic growth peptide (OGP), retains the full OGP-like activity. Osteogenic Growth Peptide (10-14) is responsible for the binding to the OGP receptor and activates an intracellular Gi-protein-MAP kinase signaling pathway. Osteogenic Growth Peptide (10-14) is a potent mitogen and stimulator of osteogenesis and hematopoiesis. Osteogenic Growth Peptide (10-14) acts as a Src inhibitor .
    Osteogenic Growth Peptide (10-14)
  • HY-P5182A
    HsTX1 TFA

    		Potassium Channel Inflammation/Immunology
    HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
    HsTX1 TFA
  • HY-P5461
    CHRG01

    		Bacterial Others
    CHRG01 is a biological active peptide. (CHRG01 is derived from human b-defensin 3 (hBD3) C-terminal amino acids 54 to 67, with all Cys residues substituted with Ser. This substitution removes all disulfide bond linkages within the sequence. CHRG01, like hBD3, displays electrostatic-dependent antimicrobial properties.)
    CHRG01
  • HY-P5771
    Jingzhaotoxin-IX

    		Sodium Channel Neurological Disease
    Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .
    Jingzhaotoxin-IX
  • HY-P3431
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

    		iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-P1769
    Angiotensin II (5-8), human

    		Angiotensin Receptor Metabolic Disease Endocrinology
    Angiotensin II (5-8), human is an endogenous C-terminal fragment of the peptide vasoconstrictor angiotensin II . Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca 2+ levels. Angiotensin II also acts at the Na +/H + exchanger in the proximal tubules of the kidney .
    Angiotensin II (5-8), human
  • HY-P3431A
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

    		iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
  • HY-P5693
    HBA(111–142)

    		Bacterial CMV HSV Infection
    HBA(111-142), an antimicrobial peptide, is a C-terminal 32-mer fragment of alpha-hemoglobin. HBA(111-142) has antibacterial activity against the ESKAPE panel of pathogens. HBA(111-142) forms amyloid fibrils, and has antiviral activities. HBA(111-142) inhibits measles and herpes viruses (HSV-1, HSV-2, HCMV) .
    HBA(111–142)
  • HY-P3982
    CKLF1-C19

    		CCR Inflammation/Immunology
    CKLF1-C19 is the C-terminal peptide of human chemokine-like factor 1 (CKLF1). CKLF1-C19 interacts with CCR4, and inhibits chemotaxis induced by both CKLF1 and CCL17. CKLF1-C19 can suppress allergic lung inflammation via inhibiting chemotaxis mediated by CCR3 and CCR4 .
    CKLF1-C19
  • HY-P1210
    Lys-γ3-MSH(human)

    		Melanocortin Receptor Endocrinology
    Lys-γ3-MSH(human) is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
    Lys-γ3-MSH(human)
  • HY-P1210A
    Lys-γ3-MSH(human) TFA

    		Melanocortin Receptor Endocrinology
    Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) TFA is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) TFA can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
    Lys-γ3-MSH(human) TFA
  • HY-P2535
    Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human

    		GLP Receptor Metabolic Disease
    Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human is an C-terminal-labelled biotinylated GLP-1 (7-36) amide.
    Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: